rowan

Rowan is a cloud-native molecular modeling and medicinal-chemistry workflow platform with a Python API. Use for pKa and macropKa prediction, conformer and tautomer ensembles, docking and analogue docking, protein-ligand cofolding, MSA generation, molecular dynamics, permeability, descriptor workflows, and related small-molecule or protein modeling tasks. Ideal for programmatic batch screening, multi-step chemistry pipelines, and workflows that would otherwise require maintaining local HPC/GPU infrastructure.

Install

Hot:4

Download and extract to your skills directory

Copy command and send to AI Agent for auto-install:

Download and install this skill https://openskills.cc/api/download?slug=k-dense-ai-skills-rowan&locale=en&source=copy
name:rowandescription:Rowan is a cloud-native molecular modeling and medicinal-chemistry workflow platform with a Python API. Use for pKa and macropKa prediction, conformer and tautomer ensembles, docking and analogue docking, protein-ligand cofolding, MSA generation, molecular dynamics, permeability, descriptor workflows, and related small-molecule or protein modeling tasks. Ideal for programmatic batch screening, multi-step chemistry pipelines, and workflows that would otherwise require maintaining local HPC/GPU infrastructure.license:Proprietary (API key required)compatibility:Python 3.12+, API key requiredrequired_environment_variables:[object Object]metadata:[object Object]

Rowan: Cloud-Native Molecular-Modeling and Drug-Design Workflows

Overview

Rowan is a cloud-native workflow platform for molecular simulation, medicinal chemistry, and structure-based design. Its Python API exposes a unified interface for small-molecule modeling, property prediction, docking, molecular dynamics, and AI structure workflows.

Use Rowan when you want to run medicinal-chemistry or molecular-design workflows programmatically without maintaining local HPC infrastructure, GPU provisioning, or a collection of separate modeling tools. Rowan handles all infrastructure, result management, and computation scaling.

When to use Rowan

Rowan is a good fit for:

  • Quantum chemistry, semiempirical methods, or neural network potentials

  • Batch property prediction (pKa, descriptors, permeability, solubility)

  • Conformer and tautomer ensemble generation

  • Docking workflows (single-ligand, analogue series, pose refinement)

  • Protein-ligand cofolding and MSA generation

  • Multi-step chemistry pipelines (e.g., tautomer search → docking → pose analysis)

  • Batch medicinal-chemistry campaigns where you need consistent, scalable infrastructure
  • Rowan is not the right fit for:

  • Simple molecular I/O (use RDKit directly)

  • Post-HF ab initio quantum chemistry or relativistic calculations
  • Access and pricing model

    Rowan uses a credit-based usage model. All users, including free-tier users, can create API keys and use the Python API.

    Free-tier access

  • Access to all Rowan core workflows

  • 20 credits per week

  • 500 signup credits
  • Pricing and credit consumption

    Credits are consumed according to compute type:

  • CPU: 1 credit per minute

  • GPU: 3 credits per minute

  • H100/H200 GPU: 7 credits per minute
  • Purchased credits are priced per credit and remain valid for up to one year from purchase.

    Typical cost estimates

    WorkflowTypical RuntimeEstimated CreditsNotes
    Descriptors<1 min0.5–2Lightweight, good for triage
    pKa (single transition)2–5 min2–5Depends on molecule size
    MacropKa (pH 0–14)5–15 min5–15Broader sampling, higher cost
    Conformer search3–10 min3–10Ensemble quality matters
    Tautomer search2–5 min2–5Heterocyclic systems
    Docking (single ligand)5–20 min5–20Depends on pocket size, refinement
    Analogue docking series (10–50 ligands)30–120 min30–100+Shared reference frame
    MSA generation5–30 min5–30Sequence length dependent
    Protein-ligand cofolding15–60 min20–50+AI structure prediction, GPU-heavy

    Quick start

    uv pip install rowan-python

    import rowan
    rowan.api_key = "your_api_key_here"  # or set ROWAN_API_KEY env var
    
    # Submit a descriptors workflow — completes in under a minute
    wf = rowan.submit_descriptors_workflow("CC(=O)Oc1ccccc1C(=O)O", name="aspirin")
    result = wf.result()
    
    print(result.descriptors['MW'])    # 180.16
    print(result.descriptors['SLogP']) # 1.19
    print(result.descriptors['TPSA'])  # 59.44

    If that prints without error, you're set up correctly.

    Installation

    uv pip install rowan-python
    # or: pip install rowan-python

    User and webhook management

    Authentication

    Set an API key via environment variable (recommended):

    export ROWAN_API_KEY="your_api_key_here"

    Or set directly in Python:

    import rowan
    rowan.api_key = "your_api_key_here"

    Verify authentication:

    import rowan
    user = rowan.whoami()  # Returns user info if authenticated
    print(f"User: {user.email}")
    print(f"Credits available: {user.credits_available_string}")

    Webhook secret management

    For webhook signature verification, manage secrets through your user account:

    import rowan
    
    # Get your current webhook secret (returns None if none exists)
    secret = rowan.get_webhook_secret()
    if secret is None:
        secret = rowan.create_webhook_secret()
    print(f"Secret key: {secret.secret}")
    
    # Rotate your secret (invalidates old, creates new)
    # Use this periodically for security
    new_secret = rowan.rotate_webhook_secret()
    print(f"New secret created (old secret disabled): {new_secret.secret}")
    
    # Verify incoming webhook signatures
    is_valid = rowan.verify_webhook_secret(
        request_body=b"...",           # Raw request body (bytes)
        signature="X-Rowan-Signature", # From request header
        secret=secret.secret
    )

    Molecule input formats

    Rowan accepts molecules in the following formats:

  • SMILES (preferred): "CCO", "c1ccccc1O"

  • SMARTS patterns (for some workflows): subset of SMARTS for substructure matching

  • InChI (if supported in your API version): "InChI=1S/C2H6O/c1-2-3/h3H,2H2,1H3"
  • The API will validate input and raise a rowan.ValidationError if a molecule cannot be parsed. Always use canonicalized SMILES for reproducibility.

    Tip: Use RDKit to validate SMILES before submission:

    from rdkit import Chem
    smiles = "CCO"
    mol = Chem.MolFromSmiles(smiles)
    if mol is None:
        raise ValueError(f"Invalid SMILES: {smiles}")

    Core usage pattern

    Most Rowan tasks follow the same three-step pattern:

  • Submit a workflow

  • Wait for completion (with optional streaming)

  • Retrieve typed results with convenience properties
  • import rowan
    
    # 1. Submit — use the specific workflow function (not the generic submit_workflow)
    workflow = rowan.submit_descriptors_workflow(
        "CC(=O)Oc1ccccc1C(=O)O",
        name="aspirin descriptors",
    )
    
    # 2. & 3. Wait and retrieve
    result = workflow.result()  # Blocks until done (default: wait=True, poll_interval=5)
    print(result.data)              # Raw dict
    print(result.descriptors['MW']) # 180.16 — use result.descriptors dict, not result.molecular_weight

    For long-running workflows, use streaming:

    for partial in workflow.stream_result(poll_interval=5):
        print(f"Progress: {partial.complete}%")
        print(partial.data)

    result() vs. stream_result()

    PatternUse WhenDuration
    result()You can wait for the full result<5 min typical
    stream_result()You want progress feedback or need early partial results>5 min, or interactive use

    Guideline: Use result() for descriptors, pKa. Use stream_result() for conformer search, docking, cofolding.

    Working with results

    Rowan's API includes typed workflow result objects with convenience properties.

    Using typed properties and .data

    Results have two access patterns:

  • Convenience properties (recommended first): result.descriptors, result.best_pose, result.conformer_energies

  • Raw fallback: result.data — raw dictionary from the API
  • Example:

    result = rowan.submit_descriptors_workflow(
        "CCO",
        name="ethanol",
    ).result()
    
    # Convenience property (returns dict of all descriptors):
    print(result.descriptors['MW'])   # 46.042
    print(result.descriptors['SLogP'])  # -0.001
    print(result.descriptors['TPSA'])   # 57.96
    
    # Raw data fallback (descriptors are nested under 'descriptors' key):
    print(result.data['descriptors'])
    # {'MW': 46.042, 'SLogP': -0.001, 'TPSA': 57.96, 'nHBDon': 1.0, 'nHBAcc': 1.0, ...}

    Note: DescriptorsResult does not have a molecular_weight property. Descriptor keys use short names (MW, SLogP, nHBDon) not verbose names.

    Cache invalidation

    Some result properties are lazily loaded (e.g., conformer geometries, protein structures). To refresh:

    result.clear_cache()
    new_structures = result.conformer_molecules  # Refetched

    Projects, folders, and organization

    For nontrivial campaigns, use projects and folders to keep work organized.

    Projects

    import rowan
    
    # Create a project
    project = rowan.create_project(name="CDK2 lead optimization")
    rowan.set_project("CDK2 lead optimization")
    
    # All subsequent workflows go into this project
    wf = rowan.submit_descriptors_workflow("CCO", name="test compound")
    
    # Retrieve later
    project = rowan.retrieve_project("CDK2 lead optimization")
    workflows = rowan.list_workflows(project=project, size=50)

    Folders

    # Create a hierarchical folder structure
    folder = rowan.create_folder(name="docking/batch_1/screening")
    
    wf = rowan.submit_docking_workflow(
        # ... docking params ...
        folder=folder,
        name="compound_001",
    )
    
    # List workflows in a folder
    results = rowan.list_workflows(folder=folder)

    Workflow decision trees

    pKa vs. MacropKa

    Use microscopic pKa when:

  • You need the pKa of a single ionizable group

  • You're interested in acid–base transitions and protonation thermodynamics

  • The molecule has one or two ionizable sites

  • Speed is critical (faster, fewer credits)
  • Use macropKa when:

  • You need pH-dependent behavior across a physiologically relevant range (e.g., 0–14)

  • You want aggregated charge and protonation-state populations across pH

  • The molecule has multiple ionizable groups with coupled protonation

  • You need downstream properties like aqueous solubility at different pH
  • Example decision:

    Phenol (pKa ~10): Use microscopic pKa
    Amine (pKa ~9–10): Use microscopic pKa
    Multi-ionizable drug (N, O, acidic group): Use macropKa
    ADME assessment across GI pH: Use macropKa

    Conformer search vs. tautomer search

    Use conformer search when:

  • A single tautomeric form is known

  • You need a diverse 3D ensemble for docking, MD, or SAR analysis

  • Rotatable bonds dominate the chemical space
  • Use tautomer search when:

  • Tautomeric equilibrium is uncertain (e.g., heterocycles, keto–enol systems)

  • You need to model all relevant protonation isomers

  • Downstream calculations (docking, pKa) depend on tautomeric form
  • Combined workflow:

    # Step 1: Find best tautomer
    taut_wf = rowan.submit_tautomer_search_workflow(
        initial_molecule="O=c1[nH]ccnc1",
        name="imidazole tautomers",
    )
    best_taut = taut_wf.result().best_tautomer
    
    # Step 2: Generate conformers from best tautomer
    conf_wf = rowan.submit_conformer_search_workflow(
        initial_molecule=best_taut,
        name="imidazole conformers",
    )

    Docking vs. analogue docking vs. cofolding

    WorkflowUse WhenInputOutput
    DockingSingle ligand, known pocketProtein + SMILES + pocket coordsPose, score, dG
    Analogue docking5–100+ related compoundsProtein + SMILES list + reference ligandAll poses, reference-aligned
    Protein-ligand cofoldingSequence + ligand, no crystal structureProtein sequence + SMILESML-predicted bound complex

    Common workflow categories

    1. Descriptors

    A lightweight entry point for batch triage, SAR, or exploratory scripts.

    wf = rowan.submit_descriptors_workflow(
        "CC(=O)Oc1ccccc1C(=O)O",  # positional arg, accepts SMILES string
        name="aspirin descriptors",
    )
    
    result = wf.result()
    print(result.descriptors['MW'])    # 180.16
    print(result.descriptors['SLogP']) # 1.19
    print(result.descriptors['TPSA'])  # 59.44
    print(result.data['descriptors'])
    # {'MW': 180.16, 'SLogP': 1.19, 'TPSA': 59.44, 'nHBDon': 1.0, 'nHBAcc': 4.0, ...}

    Common descriptor keys:

    KeyDescriptionTypical drug range
    MWMolecular weight (Da)<500 (Lipinski)
    SLogPCalculated LogP (lipophilicity)-2 to +5
    TPSATopological polar surface area (Ų)<140 for oral bioavailability
    nHBDonH-bond donor count≤5 (Lipinski)
    nHBAccH-bond acceptor count≤10 (Lipinski)
    nRotRotatable bond count<10 for oral drugs
    nRingRing count
    nHeavyAtomHeavy atom count
    FilterItLogSEstimated aqueous solubility (LogS)>-4 preferred
    LipinskiLipinski Ro5 pass (1.0) or fail (0.0)

    The result contains hundreds of additional molecular descriptors (BCUT, GETAWAY, WHIM, etc.); access any via result.descriptors['key'].

    2. Microscopic pKa

    For protonation-state energetics and acid/base behavior of a specific structure.

    Two methods are available:

    MethodInputSpeedCoversUse when
    chemprop_nevolianis2025SMILES stringFastDeprotonation only (anionic conjugate bases)Acidic groups only; quick screening
    starlingSMILES stringFastAcid + base (full protonation/deprotonation)Most drug-like molecules; preferred SMILES method
    aimnet2_wagen2024 (default)3D molecule objectSlower, higher accuracyAcid + baseYou already have a 3D structure (e.g. from conformer search)

    # Fast path: SMILES input with full acid+base coverage (use starling method when available)
    wf = rowan.submit_pka_workflow(
        initial_molecule="c1ccccc1O",       # phenol SMILES; param is initial_molecule, not initial_smiles
        method="starling",   # fast SMILES method, covers acid+base; chemprop_nevolianis2025 is deprotonation-only
        name="phenol pKa",
    )
    
    result = wf.result()
    print(result.strongest_acid)    # 9.81 (pKa of the most acidic site)
    print(result.conjugate_bases)   # list of {pka, smiles, atom_index, ...} per deprotonatable site

    3. MacropKa

    For pH-dependent protonation behavior across a range.

    wf = rowan.submit_macropka_workflow(
        initial_smiles="CN1CCN(CC1)C2=NC=NC3=CC=CC=C32",  # imidazole
        min_pH=0,
        max_pH=14,
        min_charge=-2,  # default
        max_charge=2,   # default
        compute_aqueous_solubility=True,  # default
        name="imidazole macropKa",
    )
    
    result = wf.result()
    print(result.pka_values)               # list of pKa values
    print(result.logd_by_ph)               # dict of {pH: logD}
    print(result.aqueous_solubility_by_ph) # dict of {pH: solubility}
    print(result.isoelectric_point)        # isoelectric point
    print(result.data)
    # {'pKa_values': [...], 'logD_by_pH': {...}, 'aqueous_solubility_by_pH': {...}, ...}

    4. Conformer search

    For 3D ensemble generation when ensemble quality matters.

    wf = rowan.submit_conformer_search_workflow(
        initial_molecule="CCOC(=O)N1CCC(CC1)Oc1ncnc2ccccc12",
        num_conformers=50,  # Optional: override default
        name="conformer search",
    )
    
    result = wf.result()
    print(result.conformer_energies)  # [0.0, 1.2, 2.5, ...]
    print(result.conformer_molecules)  # List of 3D molecules
    print(result.best_conformer)  # Lowest-energy conformer

    5. Tautomer search

    For heterocycles and systems where tautomer state affects downstream modeling.

    wf = rowan.submit_tautomer_search_workflow(
        initial_molecule="O=c1[nH]ccnc1",  # or keto tautomer
        name="imidazolone tautomers",
    )
    
    result = wf.result()
    print(result.best_tautomer)  # Most stable SMILES string
    print(result.tautomers)      # List of tautomeric SMILES
    print(result.molecules)      # List of molecule objects

    6. Docking

    For protein-ligand docking with optional pose refinement and conformer generation.

    # Upload protein once, reuse in multiple workflows
    protein = rowan.upload_protein(
        name="CDK2",
        file_path="cdk2.pdb",
    )
    
    # Define binding pocket
    pocket = {
        "center": [10.5, 24.2, 31.8],
        "size": [18.0, 18.0, 18.0],
    }
    
    # Submit docking
    wf = rowan.submit_docking_workflow(
        protein=protein,
        pocket=pocket,
        initial_molecule="CCNc1ncc(c(Nc2ccc(F)cc2)n1)-c1cccnc1",
        do_pose_refinement=True,
        do_conformer_search=True,
        name="lead docking",
    )
    
    result = wf.result()
    print(result.scores)  # Docking scores (kcal/mol)
    print(result.best_pose)  # Mol object with 3D coordinates
    print(result.data)  # Raw result dict

    Protein preparation tips:

  • PDB files should be reasonably clean (remove water/heteroatoms unless intended)

  • Use the same protein object across a docking series for consistency

  • If you have a PDB ID, use rowan.create_protein_from_pdb_id() instead
  • 7. Analogue docking

    For placing a compound series into a shared binding context.

    # Analogue series (e.g., SAR campaign)
    analogues = [
        "CCNc1ncc(c(Nc2ccc(F)cc2)n1)-c1cccnc1",    # reference
        "CCNc1ncc(c(Nc2ccc(Cl)cc2)n1)-c1cccnc1",   # chloro
        "CCNc1ncc(c(Nc2ccc(OC)cc2)n1)-c1cccnc1",   # methoxy
        "CCNc1ncc(c(Nc2cc(C)c(F)cc2)n1)-c1cccnc1", # methyl, fluoro
    ]
    
    wf = rowan.submit_analogue_docking_workflow(
        analogues=analogues,
        initial_molecule=analogues[0],  # Reference ligand
        protein=protein,
        pocket=pocket,
        name="SAR series docking",
    )
    
    result = wf.result()
    print(result.analogue_scores)  # List of scores for each analogue
    print(result.best_poses)  # List of poses

    8. MSA generation

    For multiple-sequence alignment (useful for downstream cofolding).

    wf = rowan.submit_msa_workflow(
        initial_protein_sequences=[
            "MENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVP"
        ],
        output_formats=["colabfold", "chai", "boltz"],
        name="target MSA",
    )
    
    result = wf.result()
    result.download_files()  # Downloads alignments to disk

    9. Protein-ligand cofolding

    For AI-based bound-complex prediction when no crystal structure is available.

    wf = rowan.submit_protein_cofolding_workflow(
        initial_protein_sequences=[
            "MENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVP"
        ],
        initial_smiles_list=[
            "CCNc1ncc(c(Nc2ccc(F)cc2)n1)-c1cccnc1"
        ],
        name="protein-ligand cofolding",
    )
    
    result = wf.result()
    print(result.predictions)  # List of predicted structures
    print(result.messages)  # Model metadata/warnings
    
    predicted_structure = result.get_predicted_structure()
    predicted_structure.write("predicted_complex.pdb")

    All supported workflow types

    All workflows follow the same submit → wait → retrieve pattern and support webhooks and project/folder organization.

    Core molecular modeling workflows

    WorkflowFunctionWhen to use
    Descriptorssubmit_descriptors_workflowFirst-pass triage: MW, LogP, TPSA, HBA/HBD, Lipinski filter
    pKasubmit_pka_workflowSingle ionizable group; need protonation thermodynamics
    MacropKasubmit_macropka_workflowMulti-ionizable drugs; pH-dependent charge/LogD/solubility
    Conformer Searchsubmit_conformer_search_workflow3D ensemble for docking, MD, or SAR; known tautomer
    Tautomer Searchsubmit_tautomer_search_workflowHeterocycles, keto–enol; uncertain tautomeric form
    Solubilitysubmit_solubility_workflowAqueous or solvent-specific solubility prediction
    Membrane Permeabilitysubmit_membrane_permeability_workflowCaco-2, PAMPA, BBB, plasma permeability
    ADMETsubmit_admet_workflowBroad drug-likeness and ADMET property sweep

    Structure-based design workflows

    WorkflowFunctionWhen to use
    Dockingsubmit_docking_workflowSingle ligand, known binding pocket
    Analogue Dockingsubmit_analogue_docking_workflowSAR series (5–100+ compounds) in a shared pocket
    Batch Dockingsubmit_batch_docking_workflowFast library screening; large compound sets
    Protein MDsubmit_protein_md_workflowLong-timescale dynamics; conformational sampling
    Pose Analysis MDsubmit_pose_analysis_md_workflowMD refinement of a docking pose
    Protein Cofoldingsubmit_protein_cofolding_workflowNo crystal structure; AI-predicted bound complex
    Protein Binder Designsubmit_protein_binder_design_workflowDe novo binder generation against a protein target

    Advanced computational chemistry

    WorkflowFunctionWhen to use
    Basic Calculationsubmit_basic_calculation_workflowQM/ML geometry optimization or single-point energy
    Electronic Propertiessubmit_electronic_properties_workflowDipole, partial charges, HOMO-LUMO, ESP
    BDEsubmit_bde_workflowBond dissociation energies; metabolic soft-spot prediction
    Redox Potentialsubmit_redox_potential_workflowOxidation/reduction potentials
    Spin Statessubmit_spin_states_workflowSpin-state energy ordering for organometallics/radicals
    Strainsubmit_strain_workflowConformational strain relative to global minimum
    Scansubmit_scan_workflowPES scans; torsion profiles
    Multistage Optimizationsubmit_multistage_opt_workflowProgressive optimization across levels of theory

    Reaction chemistry

    WorkflowFunctionWhen to use
    Double-Ended TS Searchsubmit_double_ended_ts_search_workflowTransition state between two known structures
    IRCsubmit_irc_workflowConfirm TS connectivity; intrinsic reaction coordinate

    Advanced properties

    WorkflowFunctionWhen to use
    NMRsubmit_nmr_workflowPredicted 1H/13C chemical shifts for structure verification
    Ion Mobilitysubmit_ion_mobility_workflowCollision cross-section (CCS) for MS method development
    Hydrogen Bond Strengthsubmit_hydrogen_bond_basicity_workflowH-bond donor/acceptor strength for formulation/solubility
    Fukuisubmit_fukui_workflowSite reactivity indices for electrophilic/nucleophilic attack
    Interaction Energy Decompositionsubmit_interaction_energy_decomposition_workflowFragment-level interaction analysis

    Binding free energy

    WorkflowFunctionWhen to use
    RBFE/FEPsubmit_relative_binding_free_energy_perturbation_workflowRelative ΔΔG for congeneric series
    RBFE Graphsubmit_rbfe_graph_workflowBuild and optimize an RBFE perturbation network

    Sequence and structural biology

    WorkflowFunctionWhen to use
    MSAsubmit_msa_workflowMultiple sequence alignment for cofolding (ColabFold, Chai, Boltz)
    Solvent-Dependent Conformerssubmit_solvent_dependent_conformers_workflowSolvation-aware conformer ensembles

    Batch submission and retrieval

    For libraries or analogue series, submit in a loop using the specific workflow function. The generic rowan.batch_submit_workflow() and rowan.submit_workflow() functions currently return 422 errors from the API — use the named functions (submit_descriptors_workflow, submit_pka_workflow, etc.) instead.

    Submit a batch

    smileses = ["CCO", "CC(=O)O", "c1ccccc1O"]
    names = ["ethanol", "acetic acid", "phenol"]
    
    workflows = [
        rowan.submit_descriptors_workflow(smi, name=name)
        for smi, name in zip(smileses, names)
    ]
    
    print(f"Submitted {len(workflows)} workflows")

    Poll batch status

    statuses = rowan.batch_poll_status([wf.uuid for wf in workflows])
    # Returns aggregate counts — not per-UUID:
    # {'queued': 0, 'running': 1, 'complete': 2, 'failed': 0, 'total': 3, ...}
    
    if statuses["complete"] == statuses["total"]:
        print("All workflows done")
    elif statuses["failed"] > 0:
        print(f"{statuses['failed']} workflows failed")

    Retrieve and collect results

    results = []
    for wf in workflows:
        try:
            result = wf.result()
            results.append(result.data)
        except rowan.WorkflowError as e:
            print(f"Workflow {wf.uuid} failed: {e}")
    
    # Optionally aggregate into DataFrame
    import pandas as pd
    df = pd.DataFrame(results)

    Non-blocking / fire-and-check pattern

    For long-running workflows where you don't want to hold a process open, submit workflows, save their UUIDs, and check back later in a separate process.

    Session 1 — submit and save UUIDs:

    import rowan, json
    
    rowan.api_key = "..."
    smileses = ["CCO", "CC(=O)O", "c1ccccc1O"]
    
    workflows = [
        rowan.submit_descriptors_workflow(smi, name=f"compound_{i}")
        for i, smi in enumerate(smileses)
    ]
    
    # Save UUIDs to disk (or a database)
    uuids = [wf.uuid for wf in workflows]
    with open("workflow_uuids.json", "w") as f:
        json.dump(uuids, f)
    
    print("Submitted. Check back later.")

    Session 2 — check status and collect results when ready:

    import rowan, json
    
    rowan.api_key = "..."
    
    with open("workflow_uuids.json") as f:
        uuids = json.load(f)
    
    results = []
    for uuid in uuids:
        wf = rowan.retrieve_workflow(uuid)
        if wf.done():
            result = wf.result(wait=False)
            results.append({"uuid": uuid, "data": result.data})
        else:
            print(f"{uuid}: still running ({wf.status})")
    
    print(f"Collected {len(results)} completed results")

    Webhooks and asynchronous workflows

    For long-running campaigns or when you don't want to keep a process alive, use webhooks to notify your backend when workflows complete.

    Setting up webhooks

    Every workflow submission function accepts a webhook_url parameter:

    wf = rowan.submit_docking_workflow(
        protein=protein,
        pocket=pocket,
        initial_molecule="CCO",
        webhook_url="https://myserver.com/rowan_callback",
        name="docking with webhook",
    )
    
    print(f"Workflow submitted. Result will be POSTed to webhook when complete.")

    Webhook URLs can be passed to any specific workflow function (submit_docking_workflow(), submit_pka_workflow(), submit_descriptors_workflow(), etc.).

    Webhook authentication with secrets

    Rowan supports webhook signature verification to ensure requests are authentic. You'll need to:

  • Create or retrieve a webhook secret:
  • import rowan
    
    # Create a new webhook secret
    secret = rowan.create_webhook_secret()
    print(f"Your webhook secret: {secret.secret}")
    
    # Or retrieve an existing secret
    secret = rowan.get_webhook_secret()
    
    # Rotate your secret (invalidates old one, creates new)
    new_secret = rowan.rotate_webhook_secret()

  • Verify incoming webhook requests:
  • import rowan
    import hmac
    import json
    
    def verify_webhook(request_body: bytes, signature: str, secret: str) -> bool:
        """Verify the HMAC-SHA256 signature of a webhook request."""
        return rowan.verify_webhook_secret(request_body, signature, secret)

    Webhook payload and signature

    When a workflow completes, Rowan POSTs a JSON payload to your webhook URL with the header:

    X-Rowan-Signature: <HMAC-SHA256 signature>

    The request body contains the complete workflow result:

    {
      "workflow_uuid": "wf_12345abc",
      "workflow_type": "docking",
      "workflow_name": "lead docking",
      "status": "COMPLETED_OK",
      "created_at": "2025-04-01T12:00:00Z",
      "completed_at": "2025-04-01T12:15:30Z",
      "data": {
        "scores": [-8.2, -8.0, -7.9],
        "best_pose": {...},
        "metadata": {...}
      }
    }

    Example webhook handler with signature verification (FastAPI)

    from fastapi import FastAPI, Request, HTTPException
    import rowan
    import json
    
    app = FastAPI()
    _ws = rowan.get_webhook_secret() or rowan.create_webhook_secret()
    webhook_secret = _ws.secret
    
    @app.post("/rowan_callback")
    async def handle_rowan_webhook(request: Request):
        # Get request body and signature
        body = await request.body()
        signature = request.headers.get("X-Rowan-Signature")
    
        if not signature:
            raise HTTPException(status_code=400, detail="Missing X-Rowan-Signature header")
    
        # Verify signature
        if not rowan.verify_webhook_secret(body, signature, webhook_secret):
            raise HTTPException(status_code=401, detail="Invalid webhook signature")
    
        # Parse and process
        payload = json.loads(body)
        wf_uuid = payload["workflow_uuid"]
        status = payload["status"]
    
        if status == "COMPLETED_OK":
            print(f"Workflow {wf_uuid} succeeded!")
            result_data = payload["data"]
            # Process result, update database, trigger next workflow, etc.
        elif status == "FAILED":
            print(f"Workflow {wf_uuid} failed!")
            # Handle failure
    
        # Respond quickly to prevent retries
        return {"status": "received"}

    Webhook best practices

  • Always verify signatures using rowan.verify_webhook_secret() to ensure requests are from Rowan

  • Respond quickly (< 5 seconds); offload heavy processing to async tasks or background jobs

  • Implement idempotency: workflows may retry; handle duplicate payloads gracefully using workflow_uuid

  • Log all events for debugging and audit trails

  • Use for long campaigns: webhooks shine with 50+ workflows; for small jobs, polling with result() is simpler

  • Rotate secrets regularly using rowan.rotate_webhook_secret() for security

  • Return 2xx status to confirm receipt; Rowan may retry on 5xx errors
  • Protein utilities

    Upload proteins

    # From local PDB file
    protein = rowan.upload_protein(
        name="egfr_kinase_domain",
        file_path="egfr_kinase.pdb",
    )
    
    # From PDB database
    protein_from_pdb = rowan.create_protein_from_pdb_id(
        name="CDK2 (1M17)",
        code="1M17",
    )
    
    # Retrieve previously uploaded protein
    protein = rowan.retrieve_protein("protein-uuid")
    
    # List all proteins
    my_proteins = rowan.list_proteins()

    Protein preparation guidance

  • File format: PDB, mmCIF (Rowan auto-detects)

  • Water molecules: Rowan usually keeps relevant water; remove bulk water beforehand if desired

  • Heteroatoms: Cofactors, ions, and bound ligands are usually preserved; remove unwanted heteroatoms before upload

  • Multi-chain proteins: Fully supported

  • Resolution: Works with NMR structures, homology models, and cryo-EM; quality matters for downstream predictions

  • Validation: Rowan validates PDB syntax; severely malformed files may be rejected
  • End-to-end example: Lead optimization campaign

    This example demonstrates a realistic workflow for optimizing a hit compound:

    import rowan
    import pandas as pd
    
    # 1. Create a project and folder for organization
    project = rowan.create_project(name="CDK2 Hit Optimization")
    rowan.set_project("CDK2 Hit Optimization")
    folder = rowan.create_folder(name="round_1_tautomers_and_pka")
    
    # 2. Load hit compound and analogues
    hit = "CCNc1ncc(c(Nc2ccc(F)cc2)n1)-c1cccnc1"  # Known hit
    analogues = [
        "CCNc1ncc(c(Nc2ccccc2)n1)-c1cccnc1",      # Remove F
        "CCNc1ncc(c(Nc2ccc(Cl)cc2)n1)-c1cccnc1",  # Cl instead of F
        "CCC(C)Nc1ncc(c(Nc2ccc(F)cc2)n1)-c1cccnc1",  # Propyl instead of ethyl
    ]
    
    # 3. Determine best tautomers (just in case)
    print("Searching tautomeric forms...")
    taut_workflows = [
        rowan.submit_tautomer_search_workflow(
            smi, name=f"analog_{i}", folder=folder,
        )
        for i, smi in enumerate(analogues)
    ]
    
    best_tautomers = []
    for wf in taut_workflows:
        result = wf.result()
        best_tautomers.append(result.best_tautomer)
    
    # 4. Predict pKa and basic properties for all analogues
    print("Predicting pKa and properties...")
    pka_workflows = [
        rowan.submit_pka_workflow(
            smi, method="chemprop_nevolianis2025", name=f"pka_{i}", folder=folder,
        )
        for i, smi in enumerate(best_tautomers)
    ]
    
    descriptor_workflows = [
        rowan.submit_descriptors_workflow(smi, name=f"desc_{i}", folder=folder)
        for i, smi in enumerate(best_tautomers)
    ]
    
    # 5. Collect results
    pka_results = []
    for wf in pka_workflows:
        try:
            result = wf.result()
            pka_results.append({
                "compound": wf.name,
                "pka": result.strongest_acid,  # pKa of the strongest acid site
                "uuid": wf.uuid,
            })
        except rowan.WorkflowError as e:
            print(f"pKa prediction failed for {wf.name}: {e}")
    
    descriptor_results = []
    for wf in descriptor_workflows:
        try:
            result = wf.result()
            desc = result.descriptors
            descriptor_results.append({
                "compound": wf.name,
                "mw": desc.get("MW"),
                "logp": desc.get("SLogP"),
                "hba": desc.get("nHBAcc"),
                "hbd": desc.get("nHBDon"),
                "uuid": wf.uuid,
            })
        except rowan.WorkflowError as e:
            print(f"Descriptor calculation failed for {wf.name}: {e}")
    
    # 6. Merge and summarize
    df_pka = pd.DataFrame(pka_results)
    df_desc = pd.DataFrame(descriptor_results)
    df = df_pka.merge(df_desc, on="compound", how="outer")
    
    print("\n=== Preliminary SAR ===")
    print(df.to_string())
    
    # 7. Select promising compound for docking
    # compound names are "pka_0", "pka_1", etc. — extract index to look up SMILES
    top_idx = int(df.loc[df["pka"].idxmin(), "compound"].split("_")[1])
    top_smiles = best_tautomers[top_idx]
    
    print(f"\nProceeding with docking: {top_smiles}")
    
    # 8. Docking campaign
    protein = rowan.create_protein_from_pdb_id(name="CDK2_1CKP", code="1CKP")
    pocket = {"center": [10.5, 24.2, 31.8], "size": [18.0, 18.0, 18.0]}
    
    docking_wf = rowan.submit_docking_workflow(
        protein=protein,
        pocket=pocket,
        initial_molecule=top_smiles,
        do_pose_refinement=True,
        name=f"docking_{top_compound}",
    )
    
    dock_result = docking_wf.result()
    print(f"\nDocking score: {dock_result.scores[0]:.2f} kcal/mol")
    print(f"Best pose saved to: best_pose.pdb")
    dock_result.best_pose.write("best_pose.pdb")

    Error handling and troubleshooting

    Common errors and solutions

    import rowan
    
    # Error 1: Invalid SMILES
    try:
        wf = rowan.submit_descriptors_workflow("CCCC(CC", name="bad smiles")  # Invalid
    except rowan.ValidationError as e:
        print(f"Invalid SMILES: {e}")
        # Solution: Use RDKit to validate before submission
        from rdkit import Chem
        smi = Chem.MolToSmiles(Chem.MolFromSmiles(smi))
    
    # Error 2: API key not set
    try:
        wf = rowan.submit_descriptors_workflow("CCO")
    except rowan.AuthenticationError:
        print("API key not found. Set ROWAN_API_KEY env var or call rowan.api_key = '...'")
    
    # Error 3: Insufficient credits
    try:
        wf = rowan.submit_protein_cofolding_workflow(...)
    except rowan.InsufficientCreditsError as e:
        print(f"Not enough credits: {e}. Purchase more or reduce job size.")
    
    # Error 4: Workflow failed (bad molecule, etc.)
    try:
        wf = rowan.submit_docking_workflow(...)
        result = wf.result()
    except rowan.WorkflowError as e:
        print(f"Workflow failed: {e}")
        # Check wf.status for details
        print(f"Status: {wf.status}")
    
    # Error 5: Workflow not yet done — poll manually
    result = wf.result(wait=True, poll_interval=5)  # waits and polls every 5s
    # Or check status without blocking:
    if not wf.done():
        print("Workflow still running. Call wf.result() again later.")

    Debugging tips

  • Check workflow status: wf.status, check wf.done(), or call wf.get_status()

  • Inspect raw result: result.data instead of convenience properties

  • Re-run failed workflow: Save UUIDs and retry with rowan.retrieve_workflow(uuid)

  • Validate molecules beforehand: Use RDKit or Chemaxon before batch submission
  • Recommended usage patterns

  • Prefer Rowan-native workflows over low-level assembly when they exist

  • Use projects and folders for any nontrivial campaign (>5 workflows)

  • Use result() to block until complete (default: wait=True, poll_interval=5)

  • Use typed result properties first, fall back to .data for unmapped fields

  • Use batch submission for compound libraries or analogue series

  • Chain workflows for multi-step chemistry campaigns:

  • - pKa → macropKa → permeability (ADME assessment)
    - tautomer search → docking → pose-analysis MD (pose refinement)
    - MSA generation → protein-ligand cofolding (AI structure prediction)
  • Use webhooks for long-running campaigns (>50 workflows) or asynchronous pipelines

  • Use streaming for interactive feedback on large conformer/docking searches
  • Summary

    Use Rowan when your workflow requires cloud execution for molecular-design tasks, especially when you want one unified API and consistent result handling across small-molecule modeling, proteins, docking, ADME prediction, and ML structure generation.

    Rowan is a molecular-design workflow platform, not just a remote chemistry engine. It handles infrastructure scaling, result persistence, and multi-step pipeline orchestration so you can focus on science.